Lineage for d3m8ra1 (3m8r A:294-422)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2137193Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2139124Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 2139729Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (17 proteins)
    contains Pfam PF00929
  6. 2139920Protein Exonuclease domain of prokaryotic DNA polymerase [53119] (3 species)
    part of Klenow fragment, KF
  7. 2139985Species Thermus aquaticus [TaxId:271] [53121] (29 PDB entries)
  8. 2139991Domain d3m8ra1: 3m8r A:294-422 [213153]
    Other proteins in same PDB: d3m8ra2
    automated match to d1jxea1
    protein/DNA complex; complexed with 15p, act, gol, hxz, mg

Details for d3m8ra1

PDB Entry: 3m8r (more details), 2 Å

PDB Description: Crystal structure of the large fragment of DNA polymerase I from Thermus aquaticus in a closed ternary complex with trapped 4'-ethylated dTTP
PDB Compounds: (A:) DNA polymerase I, thermostable

SCOPe Domain Sequences for d3m8ra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3m8ra1 c.55.3.5 (A:294-422) Exonuclease domain of prokaryotic DNA polymerase {Thermus aquaticus [TaxId: 271]}
leeapwpppegafvgfvlsrkepmwadllalaaarggrvhrapepykalrdlkearglla
kdlsvlalreglglppgddpmllaylldpsnttpegvarryggewteeageraalserlf
anlwgrleg

SCOPe Domain Coordinates for d3m8ra1:

Click to download the PDB-style file with coordinates for d3m8ra1.
(The format of our PDB-style files is described here.)

Timeline for d3m8ra1: