Lineage for d3ly2g_ (3ly2 G:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2349642Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2349643Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 2349733Family a.211.1.2: PDEase [48548] (7 proteins)
    Pfam PF00233; multihelical; can be divided into three subdomains
  6. 2349737Protein Catalytic domain of cyclic nucleotide phosphodiesterase 4b2b [48549] (1 species)
  7. 2349738Species Human (Homo sapiens) [TaxId:9606] [48550] (31 PDB entries)
    Uniprot Q07343 324-667
  8. 2349782Domain d3ly2g_: 3ly2 G: [213101]
    Other proteins in same PDB: d3ly2a2, d3ly2b2
    automated match to d3d3pa_
    complexed with mg, so4, z72, zn

Details for d3ly2g_

PDB Entry: 3ly2 (more details), 2.6 Å

PDB Description: Catalytic Domain of Human Phosphodiesterase 4B in Complex with A Coumarin-Based Inhibitor
PDB Compounds: (G:) cAMP-specific 3',5'-cyclic phosphodiesterase 4B

SCOPe Domain Sequences for d3ly2g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ly2g_ a.211.1.2 (G:) Catalytic domain of cyclic nucleotide phosphodiesterase 4b2b {Human (Homo sapiens) [TaxId: 9606]}
rfgvntenedhlakeledlnkwglnifnvagyshnrpltcimyaifqerdllktfrissd
tfitymmtledhyhsdvayhnslhaadvaqsthvllstpaldavftdleilaaifaaaih
dvdhpgvsnqflintnselalmyndesvlenhhlavgfkllqeehcdifmnltkkqrqtl
rkmvidmvlatdmskhmslladlktmvetkkvtssgvllldnytdriqvlrnmvhcadls
nptkslelyrqwtdrimeeffqqgdkerergmeispmcdkhtasveksqvgfidyivhpl
wetwadlvqpdaqdildtlednrnwyqsmipq

SCOPe Domain Coordinates for d3ly2g_:

Click to download the PDB-style file with coordinates for d3ly2g_.
(The format of our PDB-style files is described here.)

Timeline for d3ly2g_: