Lineage for d3lvza_ (3lvz A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1679369Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 1679370Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 1679371Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)
  6. 1679510Protein automated matches [190079] (7 species)
    not a true protein
  7. 1679535Species Bradyrhizobium japonicum [TaxId:224911] [226051] (2 PDB entries)
  8. 1679538Domain d3lvza_: 3lvz A: [213075]
    automated match to d2gmna1
    complexed with zn

Details for d3lvza_

PDB Entry: 3lvz (more details), 1.4 Å

PDB Description: New refinement of the crystal structure of BJP-1, a subclass B3 metallo-beta-lactamase of Bradyrhizobium japonicum
PDB Compounds: (A:) Blr6230 protein

SCOPe Domain Sequences for d3lvza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lvza_ d.157.1.1 (A:) automated matches {Bradyrhizobium japonicum [TaxId: 224911]}
ikdflavamkkwtapfepfqlidniyyvgtdgiavyviktsqglilmdtampqstgmikd
niaklgfkvadiklilnthahldhtggfaeikketgaqlvagerdkplleggyypgdekn
edlafpavkvdravkegdrvtlgdttltahatpghspgctswemtvkdgkedrevlffcs
gtvalnrlvgqptyagivddyratfakakamkidvllgphpevygmqakraemkdgapnp
fikpgelvtyatslsedfdkqlakqtaalekk

SCOPe Domain Coordinates for d3lvza_:

Click to download the PDB-style file with coordinates for d3lvza_.
(The format of our PDB-style files is described here.)

Timeline for d3lvza_: