SCOPe 2.04: Domain d3lo8a1: 3lo8 A:8-156

Lineage for d3lo8a1 (3lo8 A:8-156)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families)

5. Family b.43.4.0: automated matches [227162] (1 protein)
   not a true family

6. Protein automated matches [226870] (16 species)
   not a true protein

7. Species Maize (Zea mays) [TaxId:4577] [226539] (5 PDB entries)

8. Domain d3lo8a1: 3lo8 A:8-156 [212979]
   Other proteins in same PDB: d3lo8a2
   automated match to d1frna1
   complexed with fad, na

Details for d3lo8a1

PDB Entry: 3lo8, 1.05 Å

PDB Description: crystal structure of the oxidized form of ferredoxin:nadp+ reductase from maize root at 1.05 angstroms

PDB Compounds: (A:) ferredoxin--nadp reductase

SCOPe Domain Sequences for d3lo8a1:

Sequence; same for both SEQRES and ATOM records:

>d3lo8a1 b.43.4.0 (A:8-156) automated matches {Maize (Zea mays) [TaxId: 4577]}
skvsvaplhlesakepplntykpkepftativsveslvgpkapgetchividhggnvpyw
egqsygvippgenpkkpgapqnvrlysiastrygdnfdgrtgslcvrravyydpetgked
pskngvcsnflcnskpgdkiqltgpsgki

Timeline for d3lo8a1:

• d3lo8a1 first appeared in SCOPe 2.03
  
• d3lo8a1 appears in SCOPe 2.05
  
• d3lo8a1 appears in the current release, SCOPe 2.08