SCOPe 2.07: Domain d3lndc1: 3lnd C:4-99

Lineage for d3lndc1 (3lnd C:4-99)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.6: Cadherin-like [49313] (3 families)

5. Family b.1.6.0: automated matches [191376] (1 protein)
   not a true family

6. Protein automated matches [190458] (4 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [187373] (15 PDB entries)

8. Domain d3lndc1: 3lnd C:4-99 [212954]
   automated match to d1ncja1
   complexed with ca

Details for d3lndc1

PDB Entry: 3lnd, 2.82 Å

PDB Description: crystal structure of cadherin-6 ec12 w4a

PDB Compounds: (C:) Cdh6 protein

SCOPe Domain Sequences for d3lndc1:

Sequence; same for both SEQRES and ATOM records:

>d3lndc1 b.1.6.0 (C:4-99) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
anqfflleeytgsdyqyvgklhsdqdrgdgslkyilsgdgagdlfiinentgdiqatkrl
dreekpvyilraqavnrrtgrpvepesefiikihdi

Timeline for d3lndc1:

• d3lndc1 first appeared in SCOPe 2.03
  
• d3lndc1 appears in SCOPe 2.06
  
• d3lndc1 appears in the current release, SCOPe 2.08