Lineage for d3lncb_ (3lnc B:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1593542Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1593543Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1597921Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 1597922Protein automated matches [190123] (79 species)
    not a true protein
  7. 1597933Species Anaplasma phagocytophilum [TaxId:212042] [225837] (1 PDB entry)
  8. 1597935Domain d3lncb_: 3lnc B: [212949]
    automated match to d2f3rb_
    complexed with 5gp

Details for d3lncb_

PDB Entry: 3lnc (more details), 1.95 Å

PDB Description: crystal structure of guanylate kinase from anaplasma phagocytophilum
PDB Compounds: (B:) Guanylate kinase

SCOPe Domain Sequences for d3lncb_:

Sequence, based on SEQRES records: (download)

>d3lncb_ c.37.1.0 (B:) automated matches {Anaplasma phagocytophilum [TaxId: 212042]}
smlksvgvilvlsspsgcgkttvankllekqknnivksvsvttraarkgekegkdyyfvd
reeflrlcsngeiiehaevfgnfygvprknlednvdkgvstllvidwqgafkfmemmreh
vvsifimppsmeelrrrlcgrraddsevvearlkgaafeishceaydyvivnedieetad
risnilraeqmktcrqvglrellesrfpie

Sequence, based on observed residues (ATOM records): (download)

>d3lncb_ c.37.1.0 (B:) automated matches {Anaplasma phagocytophilum [TaxId: 212042]}
smlksvgvilvlsspstvankllenivksvsvttraarkgekegkdyyfvdreeflrlcs
ngeiiehaevfgnfygvprknlednvdkgvstllvidwqgafkfmemmrehvvsifimpp
smeelrrrarlkgaafeishceaydyvivnedieetadrisnilraeqmktcrqvglrel
lesrfpie

SCOPe Domain Coordinates for d3lncb_:

Click to download the PDB-style file with coordinates for d3lncb_.
(The format of our PDB-style files is described here.)

Timeline for d3lncb_: