Class a: All alpha proteins [46456] (286 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.5: Calmodulin-like [47502] (24 proteins) Duplication: made with two pairs of EF-hands |
Protein automated matches [190064] (20 species) not a true protein |
Species Entamoeba histolytica [TaxId:294381] [225835] (3 PDB entries) |
Domain d3li6j_: 3li6 J: [212900] automated match to d2nxqa_ complexed with ca |
PDB Entry: 3li6 (more details), 2.5 Å
SCOPe Domain Sequences for d3li6j_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3li6j_ a.39.1.5 (J:) automated matches {Entamoeba histolytica [TaxId: 294381]} aealfkeidvngdgavsyeevkafvskkraikneqllqlifksidadgngeidqnefakf ygsi
Timeline for d3li6j_: