Lineage for d3li2b1 (3li2 B:39-324)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2519619Fold c.92: Chelatase-like [53799] (3 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 2519730Superfamily c.92.2: "Helical backbone" metal receptor [53807] (5 families) (S)
    contains a long alpha helical insertion in the interdomain linker
  5. 2520116Family c.92.2.0: automated matches [191548] (1 protein)
    not a true family
  6. 2520117Protein automated matches [190944] (40 species)
    not a true protein
  7. 2520241Species Staphylococcus aureus [TaxId:426430] [225834] (2 PDB entries)
  8. 2520244Domain d3li2b1: 3li2 B:39-324 [212896]
    Other proteins in same PDB: d3li2a2, d3li2b2
    automated match to d3tefa_
    complexed with act, fe, sf8, zn

Details for d3li2b1

PDB Entry: 3li2 (more details), 2.2 Å

PDB Description: Closed Conformation of HtsA Complexed with Staphyloferrin A
PDB Compounds: (B:) Ferrichrome ABC transporter lipoprotein

SCOPe Domain Sequences for d3li2b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3li2b1 c.92.2.0 (B:39-324) automated matches {Staphylococcus aureus [TaxId: 426430]}
isvkdengtvkvpkdakrivvleysfadalaaldvkpvgiaddgkkkriikpvrekigdy
tsvgtrkqpnleeisklkpdliiadssrhkginkelnkiaptlslksfdgdykqninsfk
tiakalnkekegekrlaehdklinkykdeikfdrnqkvlpavvakagllahpnysyvgqf
lnelgfknalsddvtkglskylkgpylqldtehladlnpermiimtdhakkdsaefkklq
edatwkklnavknnrvdivdrdvwarsrglisseemakelvelskk

SCOPe Domain Coordinates for d3li2b1:

Click to download the PDB-style file with coordinates for d3li2b1.
(The format of our PDB-style files is described here.)

Timeline for d3li2b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3li2b2