Lineage for d3lf2b_ (3lf2 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2848075Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [196452] (30 PDB entries)
  8. 2848126Domain d3lf2b_: 3lf2 B: [212863]
    automated match to d3lf1b_
    complexed with cl, gol, ndp, so4

Details for d3lf2b_

PDB Entry: 3lf2 (more details), 2.3 Å

PDB Description: nadph bound structure of the short chain oxidoreductase q9hya2 from pseudomonas aeruginosa pao1 containing an atypical catalytic center
PDB Compounds: (B:) Short Chain OxidoReductase Q9HYA2

SCOPe Domain Sequences for d3lf2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lf2b_ c.2.1.0 (B:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
pydlseavavvtggssgiglatvellleagaavafcardgerlraaesalrqrfpgarlf
asvcdvldalqvrafaeacertlgcasilvnnagqgrvstfaettdeawseelqlkffsv
ihpvraflpqlesradaaivcvnsllasqpephmvatsaaragvknlvrsmafefapkgv
rvngiliglvesgqwrrrfeareereldwaqwtaqlarnkqiplgrlgkpieaarailfl
asplsayttgshidvsgglsrha

SCOPe Domain Coordinates for d3lf2b_:

Click to download the PDB-style file with coordinates for d3lf2b_.
(The format of our PDB-style files is described here.)

Timeline for d3lf2b_: