Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) duplication contains two domains of this fold |
Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
Protein automated matches [226839] (64 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [224896] (72 PDB entries) |
Domain d3ldnb2: 3ldn B:215-407 [212845] automated match to d1ngfa2 |
PDB Entry: 3ldn (more details), 2.2 Å
SCOPe Domain Sequences for d3ldnb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ldnb2 c.55.1.0 (B:215-407) automated matches {Human (Homo sapiens) [TaxId: 9606]} egeknilvfdlgggtfdvslltidngvfevvatngdthlggedfdqrvmehfiklykkkt gkdvrkdnravqklrrevekakralssqhqarieiesfyegedfsetltrakfeelnmdl frstmkpvqkvledsdlkksdideivlvggstripkiqqlvkeffngkepsrginpdeav aygaavqagvlsg
Timeline for d3ldnb2: