SCOPe 2.08: Domain d3lcpa_: 3lcp A:

Lineage for d3lcpa_ (3lcp A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.13: Lectin leg-like [74904] (4 proteins)
   mammalian protein related to legume lectins
   automatically mapped to Pfam PF03388

6. Protein automated matches [190462] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [197238] (11 PDB entries)

8. Domain d3lcpa_: 3lcp A: [212814]
   automated match to d4gkxb_
   complexed with ca

Details for d3lcpa_

PDB Entry: 3lcp, 2.45 Å

PDB Description: Crystal structure of the carbohydrate recognition domain of LMAN1 in complex with MCFD2

PDB Compounds: (A:) Protein ERGIC-53

SCOPe Domain Sequences for d3lcpa_:

Sequence; same for both SEQRES and ATOM records:

>d3lcpa_ b.29.1.13 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lphrrfeykysfkgphlvqsdgtvpfwahagnaipssdqirvapslksqrgsvwtktkaa
fenwevevtfrvtgrgrigadglaiwyaenqglegpvfgsadlwngvgiffdsfdndgkk
nnpaiviignngqihydhqndgasqalascqrdfrnkpypvrakityyqntltvminngf
tpdkndyefcakvenmiipaqghfgisaatggladdhdvlsfltfqltepgkep

Timeline for d3lcpa_:

• d3lcpa_ first appeared in SCOPe 2.03
  
• d3lcpa_ appears in SCOPe 2.07