Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.96: T-fold [55619] (2 superfamilies) beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234 tunnel-shaped: its known members form wide oligomeric barrels different sizes |
Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families) bind purine or pterin in topologically similar sites between subunits |
Family d.96.1.0: automated matches [227243] (1 protein) not a true family |
Protein automated matches [227009] (16 species) not a true protein |
Species Aspergillus flavus [TaxId:5059] [226800] (5 PDB entries) |
Domain d3l8wa1: 3l8w A:1-136 [212758] automated match to d2yzca1 complexed with 4po, na, xan |
PDB Entry: 3l8w (more details), 1 Å
SCOPe Domain Sequences for d3l8wa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l8wa1 d.96.1.0 (A:1-136) automated matches {Aspergillus flavus [TaxId: 5059]} savkaarygkdnvrvykvhkdektgvqtvyemtvcvllegeietsytkadnsvivatdsi kntiyitakqnpvtppelfgsilgthfiekynhihaahvnivchrwtrmdidgkphphsf irdseekrnvqvdvve
Timeline for d3l8wa1: