Lineage for d3l2fm2 (3l2f M:114-390)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2214217Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily)
    duplication: common core consists of two beta-alpha-beta2-alpha repeats
  4. 2214218Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (6 families) (S)
  5. 2214486Family d.128.1.0: automated matches [227250] (1 protein)
    not a true family
  6. 2214487Protein automated matches [227028] (5 species)
    not a true protein
  7. 2214596Species Namalycastis sp. [TaxId:243920] [225847] (4 PDB entries)
  8. 2214616Domain d3l2fm2: 3l2f M:114-390 [212684]
    Other proteins in same PDB: d3l2fa1, d3l2fb1, d3l2fc1, d3l2fd1, d3l2fe1, d3l2ff1, d3l2fg1, d3l2fh1, d3l2fi1, d3l2fj1, d3l2fk1, d3l2fl1, d3l2fm1, d3l2fn1, d3l2fo1, d3l2fp1, d3l2fq1, d3l2fr1
    complexed with adp, mg, nmg, no3
    complexed with adp, mg, nmg, no3

Details for d3l2fm2

PDB Entry: 3l2f (more details), 2.3 Å

PDB Description: Glycocyamine kinase, beta-beta homodimer from marine worm Namalycastis sp., with transition state analog Mg(II)-ADP-NO3-glycocyamine. Part 1.
PDB Compounds: (M:) Glycocyamine kinase beta chain

SCOPe Domain Sequences for d3l2fm2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l2fm2 d.128.1.0 (M:114-390) automated matches {Namalycastis sp. [TaxId: 243920]}
sdkhpapdldhnklvggvfedkyvkscrircgrsvkgvclppamsraerrlvekvvsdal
gglkgdlagkyyplttmnekdqeqliedhflfekptgallttsgcardwpdgrgiwhnne
knflvwineedhirvismqkggdlkavfsrfarglleverlmkecghglmhndrlgyict
cptnmgtvvrasvhlrlaflekhprfdemlgklrlgkrgtggesslatdstydisnwarl
gkserelvqvlvdgvnlliacdkkleagqsiddmipk

SCOPe Domain Coordinates for d3l2fm2:

Click to download the PDB-style file with coordinates for d3l2fm2.
(The format of our PDB-style files is described here.)

Timeline for d3l2fm2: