Lineage for d1g9nh2 (1g9n H:130-229)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2358964Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (7 species)
  7. 2358971Species Human (Homo sapiens) [TaxId:9606] [88575] (184 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
    Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) ! SQ NA # humanized antibody ! Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region ! SQ NA # engineered antibody
  8. 2359240Domain d1g9nh2: 1g9n H:130-229 [21267]
    Other proteins in same PDB: d1g9nc1, d1g9nc2, d1g9ng_, d1g9nh1, d1g9nl1, d1g9nl2
    part of HIV-1 neutralizing Fab 17B; binds to the CD4-induced state of gp120
    complexed with nag, ndg

Details for d1g9nh2

PDB Entry: 1g9n (more details), 2.9 Å

PDB Description: hiv-1 yu2 gp120 envelope glycoprotein complexed with cd4 and induced neutralizing antibody 17b
PDB Compounds: (H:) antibody 17b, heavy chain

SCOPe Domain Sequences for d1g9nh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g9nh2 b.1.1.2 (H:130-229) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
stkgpsvfplapsskstsggtaalgclvkdyfpqpvtvswnsgaltsgvhtfpavlqssg
lyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk

SCOPe Domain Coordinates for d1g9nh2:

Click to download the PDB-style file with coordinates for d1g9nh2.
(The format of our PDB-style files is described here.)

Timeline for d1g9nh2: