Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (7 species) |
Species Human (Homo sapiens) [TaxId:9606] [88575] (184 PDB entries) including humanized antibodies (chimeric proteins with human constant domains) Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) ! SQ NA # humanized antibody ! Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region ! SQ NA # engineered antibody |
Domain d1g9nh2: 1g9n H:130-229 [21267] Other proteins in same PDB: d1g9nc1, d1g9nc2, d1g9ng_, d1g9nh1, d1g9nl1, d1g9nl2 part of HIV-1 neutralizing Fab 17B; binds to the CD4-induced state of gp120 complexed with nag, ndg |
PDB Entry: 1g9n (more details), 2.9 Å
SCOPe Domain Sequences for d1g9nh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g9nh2 b.1.1.2 (H:130-229) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]} stkgpsvfplapsskstsggtaalgclvkdyfpqpvtvswnsgaltsgvhtfpavlqssg lyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
Timeline for d1g9nh2: