SCOPe 2.05: Domain d3l0ob1: 3l0o B:58-130

Lineage for d3l0ob1 (3l0o B:58-130)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families)

5. Family b.40.4.0: automated matches [191416] (1 protein)
   not a true family

6. Protein automated matches [190576] (23 species)
   not a true protein

7. Species Thermotoga maritima [TaxId:2336] [225895] (2 PDB entries)

8. Domain d3l0ob1: 3l0o B:58-130 [212639]
   Other proteins in same PDB: d3l0ob2
   automated match to d1xpoa2
   complexed with ium, na, so4

Details for d3l0ob1

PDB Entry: 3l0o, 2.35 Å

PDB Description: Structure of RNA-free Rho transcription termination factor from Thermotoga maritima

PDB Compounds: (B:) transcription termination factor rho

SCOPe Domain Sequences for d3l0ob1:

Sequence, based on SEQRES records:

>d3l0ob1 b.40.4.0 (B:58-130) automated matches {Thermotoga maritima [TaxId: 2336]}
gegvleihpegfgflrriednllpsnddiyispsqirkfnlntgdiisgvirkpkegeky
famikieainyrp

Sequence, based on observed residues (ATOM records):

>d3l0ob1 b.40.4.0 (B:58-130) automated matches {Thermotoga maritima [TaxId: 2336]}
gegvleihpegfgflrriednllpsnddiyispsqirkfnlntgdiisgviamikieain
yrp

Timeline for d3l0ob1:

• d3l0ob1 first appeared in SCOPe 2.03
  
• d3l0ob1 appears in SCOPe 2.04
  
• d3l0ob1 appears in SCOPe 2.06
  
• d3l0ob1 appears in the current release, SCOPe 2.08