Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies) core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids |
Superfamily d.41.2: Nicotinate/Quinolinate PRTase N-terminal domain-like [54675] (4 families) |
Family d.41.2.0: automated matches [227168] (1 protein) not a true family |
Protein automated matches [226878] (11 species) not a true protein |
Species Ehrlichia chaffeensis [TaxId:205920] [225805] (1 PDB entry) |
Domain d3l0gd1: 3l0g D:2-107 [212630] Other proteins in same PDB: d3l0ga2, d3l0gb2, d3l0gc2, d3l0gd2 automated match to d1qapa2 complexed with edo, fmt |
PDB Entry: 3l0g (more details), 2.05 Å
SCOPe Domain Sequences for d3l0gd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l0gd1 d.41.2.0 (D:2-107) automated matches {Ehrlichia chaffeensis [TaxId: 205920]} kisfseiihnalkedlgdkgdittnsilinekvnfaintrenlvvcgipileevfnmnke hvkyeihkkdgditgknstlvsgealaiyllpiervilnfiqhasg
Timeline for d3l0gd1: