![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.17: Nicotinate/Quinolinate PRTase C-terminal domain-like [51690] (3 families) ![]() incomplete beta/alpha barrel with parallel beta-sheet of 7 strands |
![]() | Family c.1.17.0: automated matches [227169] (1 protein) not a true family |
![]() | Protein automated matches [226879] (8 species) not a true protein |
![]() | Species Ehrlichia chaffeensis [TaxId:205920] [225806] (1 PDB entry) |
![]() | Domain d3l0gc2: 3l0g C:108-274 [212629] Other proteins in same PDB: d3l0ga1, d3l0gb1, d3l0gc1, d3l0gd1 automated match to d1qapa1 complexed with edo, fmt |
PDB Entry: 3l0g (more details), 2.05 Å
SCOPe Domain Sequences for d3l0gc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l0gc2 c.1.17.0 (C:108-274) automated matches {Ehrlichia chaffeensis [TaxId: 205920]} iasitrqfvdevsgtkvkirstrkttpglrmldkysvcigggesyrdnlcdgvlikdnhi ascgsitlaiqrlrknlkneyiaiecdnisqveeslsnnvdmilldnmsiseikkavdiv ngksvlevsgcvnirnvrnialtgvdyisigcitnsfqnkdigldie
Timeline for d3l0gc2: