Lineage for d3kxqb_ (3kxq B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2078561Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) (S)
  5. 2078925Family c.1.1.0: automated matches [191424] (1 protein)
    not a true family
  6. 2078926Protein automated matches [190605] (21 species)
    not a true protein
  7. 2078927Species Bartonella henselae [TaxId:38323] [225801] (1 PDB entry)
  8. 2078929Domain d3kxqb_: 3kxq B: [212580]
    automated match to d2dp3a_
    complexed with edo, no3

Details for d3kxqb_

PDB Entry: 3kxq (more details), 1.6 Å

PDB Description: Crystal structure of triosephosphate isomerase from bartonella henselae at 1.6A resolution
PDB Compounds: (B:) triosephosphate isomerase

SCOPe Domain Sequences for d3kxqb_:

Sequence, based on SEQRES records: (download)

>d3kxqb_ c.1.1.0 (B:) automated matches {Bartonella henselae [TaxId: 38323]}
irpfiagnwkmngtgeslgelraiaagissdlgrlfealicvpatllsrafdilggenil
lggqnchfddygpytgdisafmlkeagashviighserrtvyqesdaivrakvqaawrag
lvalicvgetleerksnkvldvltrqlegslpdgataeniiiayepvwavgtgntatsad
vaevhafihhkmhsrfgdegakirllyggsvkpsnafellstahvngaliggaslkaidf
lticdvyrk

Sequence, based on observed residues (ATOM records): (download)

>d3kxqb_ c.1.1.0 (B:) automated matches {Bartonella henselae [TaxId: 38323]}
irpfiagnwkmngtgeslgelraiaagisfealicvpatllsrafdilggenillggqnc
hfddygpytgdisafmlkeagashviighserrtvyqesdaivrakvqaawraglvalic
vgetleerksnkvldvltrqlegslpdgataeniiiayepvwaatsadvaevhafihhkm
hsrfgdegakirllyggsvkpsnafellstahvngaliggaslkaidflticdvyrk

SCOPe Domain Coordinates for d3kxqb_:

Click to download the PDB-style file with coordinates for d3kxqb_.
(The format of our PDB-style files is described here.)

Timeline for d3kxqb_: