Lineage for d3kqfb_ (3kqf B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2460576Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2460577Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2461873Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2461874Protein automated matches [190246] (70 species)
    not a true protein
  7. 2461882Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [225790] (1 PDB entry)
  8. 2461884Domain d3kqfb_: 3kqf B: [212484]
    automated match to d3p5mf_
    complexed with ca, cl

Details for d3kqfb_

PDB Entry: 3kqf (more details), 1.8 Å

PDB Description: 1.8 angstrom resolution crystal structure of enoyl-coa hydratase from bacillus anthracis.
PDB Compounds: (B:) Enoyl-CoA hydratase/isomerase family protein

SCOPe Domain Sequences for d3kqfb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kqfb_ c.14.1.0 (B:) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
qnisvdyatphvvkislnrerqanslslalleelqniltqineeantrvviltgagekaf
cagadlkeragmneeqvrhavsmirttmemveqlpqpviaaingialgggtelslacdfr
iaaesaslgltettlaiipgaggtqrlprligvgrakeliytgrrisaqeakeyglvefv
vpvhlleekaieiaekiasngpiavrlakeaisngiqvdlhtglqmekqayegvihtkdr
leglqafkekrtpmykge

SCOPe Domain Coordinates for d3kqfb_:

Click to download the PDB-style file with coordinates for d3kqfb_.
(The format of our PDB-style files is described here.)

Timeline for d3kqfb_: