Lineage for d3kmna1 (3kmn A:1-78)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1600407Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1600408Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1602360Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 1602361Protein automated matches [190056] (133 species)
    not a true protein
  7. 1602752Species Human (Homo sapiens) [TaxId:9606] [188013] (91 PDB entries)
  8. 1602788Domain d3kmna1: 3kmn A:1-78 [212423]
    Other proteins in same PDB: d3kmna2, d3kmnb2
    automated match to d1gssa2
    complexed with ca, co3, po4; mutant

Details for d3kmna1

PDB Entry: 3kmn (more details), 1.8 Å

PDB Description: crystal structure of the human apo gst pi c47s/y108v double mutant
PDB Compounds: (A:) Glutathione S-transferase P

SCOPe Domain Sequences for d3kmna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kmna1 c.47.1.0 (A:1-78) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ppytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasslygqlpkfqdgdl
tlyqsntilrhlgrtlgl

SCOPe Domain Coordinates for d3kmna1:

Click to download the PDB-style file with coordinates for d3kmna1.
(The format of our PDB-style files is described here.)

Timeline for d3kmna1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3kmna2