SCOPe 2.08: Domain d3kkyb2: 3kky B:99-210

Lineage for d3kkyb2 (3kky B:99-210)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
   alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213

4. Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families)
   automatically mapped to Pfam PF02777

5. Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins)

6. Protein automated matches [226880] (5 species)
   not a true protein

7. Species Deinococcus radiodurans [TaxId:1299] [226011] (1 PDB entry)

8. Domain d3kkyb2: 3kky B:99-210 [212410]
   Other proteins in same PDB: d3kkya1, d3kkyb1
   automated match to d1y67a2
   complexed with mn

Details for d3kkyb2

PDB Entry: 3kky, 1.8 Å

PDB Description: Structure of Manganese Superoxide Dismutase from Deinococcus Radiodurans in the orthorhombic space group P212121: A case study of mistaken identity

PDB Compounds: (B:) Superoxide dismutase [Mn]

SCOPe Domain Sequences for d3kkyb2:

Sequence; same for both SEQRES and ATOM records:

>d3kkyb2 d.44.1.1 (B:99-210) automated matches {Deinococcus radiodurans [TaxId: 1299]}
psgelldainsafgsfdafkqkfedaaktrfgsgwawlvvkdgkldvvstanqdnplmge
aiagvsgtpilgvdvwehayylnyqnrrpdylaafwnvvnwdevskryaaak

Timeline for d3kkyb2:

• d3kkyb2 first appeared in SCOPe 2.03
  
• d3kkyb2 appears in SCOPe 2.07