PDB entry 3kky

View 3kky on RCSB PDB site
Description: Structure of Manganese Superoxide Dismutase from Deinococcus Radiodurans in the orthorhombic space group P212121: A case study of mistaken identity
Class: metal binding protein
Keywords: Superoxide dismutase, deinococcus radiodurans, Manganese, Metal-binding, Oxidoreductase, METAL BINDING PROTEIN
Deposited on 2009-11-06, released 2010-11-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-11-03, with a file datestamp of 2010-10-29.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.166
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Superoxide dismutase [Mn]
    Species: Deinococcus radiodurans [TaxId:1299]
    Gene: sodA, DR_1279
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3kkya1, d3kkya2
  • Chain 'B':
    Compound: Superoxide dismutase [Mn]
    Species: Deinococcus radiodurans [TaxId:1299]
    Gene: sodA, DR_1279
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3kkyb1, d3kkyb2
  • Heterogens: MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3kkyA (A:)
    maytlpqlpyaydalephidartmeihhtkhhqtyvdnankalegtefadlpveqliqql
    drvpadkkgalrnnagghanhsmfwqimgqgqgqnganqpsgelldainsafgsfdafkq
    kfedaaktrfgsgwawlvvkdgkldvvstanqdnplmgeaiagvsgtpilgvdvwehayy
    lnyqnrrpdylaafwnvvnwdevskryaaak
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kkyA (A:)
    aytlpqlpyaydalephidartmeihhtkhhqtyvdnankalegtefadlpveqliqqld
    rvpadkkgalrnnagghanhsmfwqimgqanqpsgelldainsafgsfdafkqkfedaak
    trfgsgwawlvvkdgkldvvstanqdnplmgeaiagvsgtpilgvdvwehayylnyqnrr
    pdylaafwnvvnwdevskryaaak
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3kkyB (B:)
    maytlpqlpyaydalephidartmeihhtkhhqtyvdnankalegtefadlpveqliqql
    drvpadkkgalrnnagghanhsmfwqimgqgqgqnganqpsgelldainsafgsfdafkq
    kfedaaktrfgsgwawlvvkdgkldvvstanqdnplmgeaiagvsgtpilgvdvwehayy
    lnyqnrrpdylaafwnvvnwdevskryaaak
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kkyB (B:)
    aytlpqlpyaydalephidartmeihhtkhhqtyvdnankalegtefadlpveqliqqld
    rvpadkkgalrnnagghanhsmfwqimgqanqpsgelldainsafgsfdafkqkfedaak
    trfgsgwawlvvkdgkldvvstanqdnplmgeaiagvsgtpilgvdvwehayylnyqnrr
    pdylaafwnvvnwdevskryaaak