SCOPe 2.08: Domain d3kksb1: 3kks B:60-208

Lineage for d3kksb1 (3kks B:60-208)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (18 families)
   consists of one domain of this fold

5. Family c.55.3.0: automated matches [191357] (1 protein)
   not a true family

6. Protein automated matches [190396] (40 species)
   not a true protein

7. Species Bovine immunodeficiency virus [TaxId:417296] [225970] (2 PDB entries)

8. Domain d3kksb1: 3kks B:60-208 [212403]
   Other proteins in same PDB: d3kksa2, d3kksb2
   automated match to d4jlha_
   complexed with act, gol

Details for d3kksb1

PDB Entry: 3kks, 2.2 Å

PDB Description: Crystal structure of catalytic core domain of BIV integrase in crystal form II

PDB Compounds: (B:) integrase

SCOPe Domain Sequences for d3kksb1:

Sequence; same for both SEQRES and ATOM records:

>d3kksb1 c.55.3.0 (B:60-208) automated matches {Bovine immunodeficiency virus [TaxId: 417296]}
lwqmdnthwnktiiwvavetnsglveaqvipeetalqvalcilqliqrytvlhlhsdngp
cftahrienlckylgitkttgipynpqsqgvverahrdlkdrlaayqgdcetveaalsla
lvslnkkrggigghtpyeiylesehtkyq

Timeline for d3kksb1:

• d3kksb1 first appeared in SCOPe 2.03, called d3kksb_
  
• d3kksb1 appears in SCOPe 2.07