Lineage for d3khyb2 (3khy B:191-384)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1605035Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1605036Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 1606124Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 1606125Protein automated matches [226839] (42 species)
    not a true protein
  7. 1606197Species Francisella tularensis [TaxId:119856] [225812] (1 PDB entry)
  8. 1606201Domain d3khyb2: 3khy B:191-384 [212361]
    automated match to d1g99a2

Details for d3khyb2

PDB Entry: 3khy (more details), 1.98 Å

PDB Description: Crystal Structure of a propionate kinase from Francisella tularensis subsp. tularensis SCHU S4
PDB Compounds: (B:) Propionate kinase

SCOPe Domain Sequences for d3khyb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3khyb2 c.55.1.0 (B:191-384) automated matches {Francisella tularensis [TaxId: 119856]}
qqkanvivahlgngcsitavvdgksidtsmgltpldglvmgtrsgcidpsifayisdnlg
wsvteitnmlnkqsgllgicghndmrevsqlaakgdslaklaieifshrvakfvasymiy
fnkldalvftggigenaanirkniisklanlgfmidhqknsnsetfinsknshnimviat
neelmiaqetqnli

SCOPe Domain Coordinates for d3khyb2:

Click to download the PDB-style file with coordinates for d3khyb2.
(The format of our PDB-style files is described here.)

Timeline for d3khyb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3khyb1