![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
![]() | Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
![]() | Protein automated matches [226839] (42 species) not a true protein |
![]() | Species Francisella tularensis [TaxId:119856] [225812] (1 PDB entry) |
![]() | Domain d3khyb2: 3khy B:191-384 [212361] automated match to d1g99a2 |
PDB Entry: 3khy (more details), 1.98 Å
SCOPe Domain Sequences for d3khyb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3khyb2 c.55.1.0 (B:191-384) automated matches {Francisella tularensis [TaxId: 119856]} qqkanvivahlgngcsitavvdgksidtsmgltpldglvmgtrsgcidpsifayisdnlg wsvteitnmlnkqsgllgicghndmrevsqlaakgdslaklaieifshrvakfvasymiy fnkldalvftggigenaanirkniisklanlgfmidhqknsnsetfinsknshnimviat neelmiaqetqnli
Timeline for d3khyb2: