SCOPe 2.05: Domain d3khva_: 3khv A:

Lineage for d3khva_ (3khv A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein Urokinase-type plasminogen activator (LMW U-PA), catalytic domain [50586] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50587] (72 PDB entries)
   Uniprot P00749 156-178,179-424

8. Domain d3khva_: 3khv A: [212357]
   automated match to d2viva_
   complexed with 4al, pge, so4

Details for d3khva_

PDB Entry: 3khv, 2.35 Å

PDB Description: crystal structures of urokinase-type plasminogen activator in complex with 4-(aminomethyl) benzoic acid and 4-(aminomethyl-phenyl)-methanol

PDB Compounds: (A:) urokinase-type plasminogen activator

SCOPe Domain Sequences for d3khva_:

Sequence, based on SEQRES records:

>d3khva_ b.47.1.2 (A:) Urokinase-type plasminogen activator (LMW U-PA), catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
iiggefttienqpwfaaiyrrhrggsvtyvcggslispcwvisathcfidypkkedyivy
lgrsrlnsntqgemkfevenlilhkdysadtlahhndiallkirskegrcaqpsrtiqti
alpsmyndpqfgtsceitgfgkeqstdylypeqlkmtvvklishrecqqphyygsevttk
mlcaadpqwktdscqgdsggplvcslqgrmtltgivswgrgcalkdkpgvytrvshflpw
irshtk

Sequence, based on observed residues (ATOM records):

>d3khva_ b.47.1.2 (A:) Urokinase-type plasminogen activator (LMW U-PA), catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
iiggefttienqpwfaaiyrrsvtyvcggslispcwvisathcfidypkkedyivylgrs
rlnsntqgemkfevenlilhkdysaahhndiallkirskegrcaqpsrtiqtialpsmyn
dpqfgtsceitgfgkeqstdylypeqlkmtvvklishrecqqphyygsevttkmlcaadp
qwktdscqgdsggplvcslqgrmtltgivswgrgcalkdkpgvytrvshflpwirshtk

Timeline for d3khva_:

• d3khva_ first appeared in SCOPe 2.03
  
• d3khva_ appears in SCOPe 2.04
  
• d3khva_ appears in SCOPe 2.06
  
• d3khva_ appears in the current release, SCOPe 2.08