SCOPe 2.08: Domain d3kcnb1: 3kcn B:6-141

Lineage for d3kcnb1 (3kcn B:6-141)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.0: automated matches [191324] (1 protein)
   not a true family

6. Protein automated matches [190131] (86 species)
   not a true protein

7. Species Rhodopirellula baltica [TaxId:265606] [225785] (1 PDB entry)

8. Domain d3kcnb1: 3kcn B:6-141 [212293]
   Other proteins in same PDB: d3kcna2, d3kcnb2
   automated match to d1l5ya_

Details for d3kcnb1

PDB Entry: 3kcn, 2.45 Å

PDB Description: the crystal structure of adenylate cyclase from rhodopirellula baltica

PDB Compounds: (B:) Adenylate cyclase homolog

SCOPe Domain Sequences for d3kcnb1:

Sequence; same for both SEQRES and ATOM records:

>d3kcnb1 c.23.1.0 (B:6-141) automated matches {Rhodopirellula baltica [TaxId: 265606]}
nerillvdddysllntlkrnlsfdfevttcesgpealacikksdpfsvimvdmrmpgmeg
teviqkarlispnsvylmltgnqdlttameavnegqvfrflnkpcqmsdikaainagikq
ydlvtskeellkktfa

Timeline for d3kcnb1:

• d3kcnb1 first appeared in SCOPe 2.03, called d3kcnb_
  
• d3kcnb1 appears in SCOPe 2.07