Lineage for d3kcnb1 (3kcn B:6-141)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2855424Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2855811Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 2855812Protein automated matches [190131] (86 species)
    not a true protein
  7. 2856101Species Rhodopirellula baltica [TaxId:265606] [225785] (1 PDB entry)
  8. 2856103Domain d3kcnb1: 3kcn B:6-141 [212293]
    Other proteins in same PDB: d3kcna2, d3kcnb2
    automated match to d1l5ya_

Details for d3kcnb1

PDB Entry: 3kcn (more details), 2.45 Å

PDB Description: the crystal structure of adenylate cyclase from rhodopirellula baltica
PDB Compounds: (B:) Adenylate cyclase homolog

SCOPe Domain Sequences for d3kcnb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kcnb1 c.23.1.0 (B:6-141) automated matches {Rhodopirellula baltica [TaxId: 265606]}
nerillvdddysllntlkrnlsfdfevttcesgpealacikksdpfsvimvdmrmpgmeg
teviqkarlispnsvylmltgnqdlttameavnegqvfrflnkpcqmsdikaainagikq
ydlvtskeellkktfa

SCOPe Domain Coordinates for d3kcnb1:

Click to download the PDB-style file with coordinates for d3kcnb1.
(The format of our PDB-style files is described here.)

Timeline for d3kcnb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3kcnb2