SCOPe 2.03: Domain d3kcnb_: 3kcn B:

Lineage for d3kcnb_ (3kcn B:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.0: automated matches [191324] (1 protein)
   not a true family

6. Protein automated matches [190131] (48 species)
   not a true protein

7. Species Rhodopirellula baltica [TaxId:265606] [225785] (1 PDB entry)

8. Domain d3kcnb_: 3kcn B: [212293]
   automated match to d1l5ya_

Details for d3kcnb_

PDB Entry: 3kcn, 2.45 Å

PDB Description: the crystal structure of adenylate cyclase from rhodopirellula baltica

PDB Compounds: (B:) Adenylate cyclase homolog

SCOPe Domain Sequences for d3kcnb_:

Sequence; same for both SEQRES and ATOM records:

>d3kcnb_ c.23.1.0 (B:) automated matches {Rhodopirellula baltica [TaxId: 265606]}
lnerillvdddysllntlkrnlsfdfevttcesgpealacikksdpfsvimvdmrmpgme
gteviqkarlispnsvylmltgnqdlttameavnegqvfrflnkpcqmsdikaainagik
qydlvtskeellkktfa

Timeline for d3kcnb_:

• d3kcnb_ is new in SCOPe 2.03-stable
  
• d3kcnb_ appears in SCOPe 2.04
  
• d3kcnb_ appears in the current release, SCOPe 2.08, called d3kcnb1