Lineage for d3kaga1 (3kag A:7-38)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2077689Fold b.72: WW domain-like [51044] (3 superfamilies)
    core: 3-stranded meander beta-sheet
  4. 2077690Superfamily b.72.1: WW domain [51045] (2 families) (S)
  5. 2077691Family b.72.1.1: WW domain [51046] (13 proteins)
  6. 2077725Protein Mitotic rotamase PIN1 [51047] (1 species)
  7. 2077726Species Human (Homo sapiens) [TaxId:9606] [51048] (37 PDB entries)
  8. 2077735Domain d3kaga1: 3kag A:7-38 [212258]
    Other proteins in same PDB: d3kaga2
    automated match to d2itka1
    complexed with 12p, 4d7

Details for d3kaga1

PDB Entry: 3kag (more details), 1.9 Å

PDB Description: structure-guided design of alpha-amino acid-derived pin1 inhibitors
PDB Compounds: (A:) Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1

SCOPe Domain Sequences for d3kaga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kaga1 b.72.1.1 (A:7-38) Mitotic rotamase PIN1 {Human (Homo sapiens) [TaxId: 9606]}
lppgwekamsrssgrvyyfnhitnasqwerps

SCOPe Domain Coordinates for d3kaga1:

Click to download the PDB-style file with coordinates for d3kaga1.
(The format of our PDB-style files is described here.)

Timeline for d3kaga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3kaga2