Class b: All beta proteins [48724] (177 folds) |
Fold b.72: WW domain-like [51044] (3 superfamilies) core: 3-stranded meander beta-sheet |
Superfamily b.72.1: WW domain [51045] (2 families) |
Family b.72.1.1: WW domain [51046] (13 proteins) |
Protein Mitotic rotamase PIN1 [51047] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [51048] (37 PDB entries) |
Domain d3kaga1: 3kag A:7-38 [212258] Other proteins in same PDB: d3kaga2 automated match to d2itka1 complexed with 12p, 4d7 |
PDB Entry: 3kag (more details), 1.9 Å
SCOPe Domain Sequences for d3kaga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3kaga1 b.72.1.1 (A:7-38) Mitotic rotamase PIN1 {Human (Homo sapiens) [TaxId: 9606]} lppgwekamsrssgrvyyfnhitnasqwerps
Timeline for d3kaga1: