Lineage for d3k88b_ (3k88 B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2403705Fold b.45: Split barrel-like [50474] (3 superfamilies)
    barrel; n=6, S=10; greek-key
  4. 2403706Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) (S)
    related to the ferredoxin reductase-like FAD-binding domain
  5. 2403929Family b.45.1.0: automated matches [191365] (1 protein)
    not a true family
  6. 2403930Protein automated matches [190439] (22 species)
    not a true protein
  7. 2403960Species Burkholderia cepacia [TaxId:292] [225782] (3 PDB entries)
  8. 2403966Domain d3k88b_: 3k88 B: [212206]
    automated match to d3cb0c_
    complexed with fad, nad

Details for d3k88b_

PDB Entry: 3k88 (more details), 2 Å

PDB Description: Crystal structure of NADH:FAD oxidoreductase (TftC) - FAD, NADH complex
PDB Compounds: (B:) Chlorophenol-4-monooxygenase component 1

SCOPe Domain Sequences for d3k88b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3k88b_ b.45.1.0 (B:) automated matches {Burkholderia cepacia [TaxId: 292]}
fetvasfdfrdalskastpvtvvatngpfglagltcsavcsvcdrpptvllcinrksyaa
giiksngvlsvnwlaagqavisqtfagvgsvpmeerfadkgwqtiatgapyrmdaavsfd
ctianivdvgshsvifaevvarnhaeectpliyhrrqyattrsl

SCOPe Domain Coordinates for d3k88b_:

Click to download the PDB-style file with coordinates for d3k88b_.
(The format of our PDB-style files is described here.)

Timeline for d3k88b_: