Lineage for d3k2cc1 (3k2c C:1-171)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2416159Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 2416160Superfamily b.62.1: Cyclophilin-like [50891] (5 families) (S)
  5. 2416161Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
    automatically mapped to Pfam PF00160
  6. 2416500Protein automated matches [190077] (21 species)
    not a true protein
  7. 2416517Species Fungus (Encephalitozoon cuniculi) [TaxId:6035] [226758] (1 PDB entry)
  8. 2416520Domain d3k2cc1: 3k2c C:1-171 [212153]
    Other proteins in same PDB: d3k2ca2, d3k2cb2, d3k2cc2, d3k2cd2
    automated match to d3ucha_
    complexed with edo, pg5, so4

Details for d3k2cc1

PDB Entry: 3k2c (more details), 1.95 Å

PDB Description: crystal structure of peptidyl-prolyl cis-trans isomerase from encephalitozoon cuniculi at 1.9 a resolution
PDB Compounds: (C:) peptidyl-prolyl cis-trans isomerase

SCOPe Domain Sequences for d3k2cc1:

Sequence, based on SEQRES records: (download)

>d3k2cc1 b.62.1.1 (C:1-171) automated matches {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]}
makeasgnvyfdvyaneeslgrivmkleddivpktaknfrtlcerpkgegykgstfhrii
pgfmvqggdytahngtggrsiygekfpdenfelkhtkegilsmancgahtngsqffitlg
ktqwldekhvvfgevvegmdvvhkiakygsesgqvkkgyrieirdcgvlgs

Sequence, based on observed residues (ATOM records): (download)

>d3k2cc1 b.62.1.1 (C:1-171) automated matches {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]}
magnvyfdvyaneeslgrivmkleddivpktaknfrtlcerpkgegykgstfhriipgfm
vqggdytahngtggrsiygekfpdenfelkhtkegilsmancgahtngsqffitlgktqw
ldekhvvfgevvegmdvvhkiakygsesgqvkkgyrieirdcgvlgs

SCOPe Domain Coordinates for d3k2cc1:

Click to download the PDB-style file with coordinates for d3k2cc1.
(The format of our PDB-style files is described here.)

Timeline for d3k2cc1: