SCOPe 2.04: Domain d3k2cc_: 3k2c C:

Lineage for d3k2cc_ (3k2c C:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.62: Cyclophilin-like [50890] (1 superfamily)
   barrel, closed; n=8, S=10; complex topology

4. Superfamily b.62.1: Cyclophilin-like [50891] (5 families)

5. Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
   automatically mapped to Pfam PF00160

6. Protein automated matches [190077] (17 species)
   not a true protein

7. Species Fungus (Encephalitozoon cuniculi) [TaxId:6035] [226758] (1 PDB entry)

8. Domain d3k2cc_: 3k2c C: [212153]
   automated match to d3ucha_
   complexed with edo, pg5, so4

Details for d3k2cc_

PDB Entry: 3k2c, 1.95 Å

PDB Description: crystal structure of peptidyl-prolyl cis-trans isomerase from encephalitozoon cuniculi at 1.9 a resolution

PDB Compounds: (C:) peptidyl-prolyl cis-trans isomerase

SCOPe Domain Sequences for d3k2cc_:

Sequence, based on SEQRES records:

>d3k2cc_ b.62.1.1 (C:) automated matches {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]}
tleaqtqgpgsmakeasgnvyfdvyaneeslgrivmkleddivpktaknfrtlcerpkge
gykgstfhriipgfmvqggdytahngtggrsiygekfpdenfelkhtkegilsmancgah
tngsqffitlgktqwldekhvvfgevvegmdvvhkiakygsesgqvkkgyrieirdcgvl
gs

Sequence, based on observed residues (ATOM records):

>d3k2cc_ b.62.1.1 (C:) automated matches {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]}
tleaqtqgpgsmagnvyfdvyaneeslgrivmkleddivpktaknfrtlcerpkgegykg
stfhriipgfmvqggdytahngtggrsiygekfpdenfelkhtkegilsmancgahtngs
qffitlgktqwldekhvvfgevvegmdvvhkiakygsesgqvkkgyrieirdcgvlgs

Timeline for d3k2cc_:

• d3k2cc_ first appeared in SCOPe 2.03
  
• d3k2cc_ appears in SCOPe 2.05
  
• d3k2cc_ appears in the current release, SCOPe 2.08, called d3k2cc1