Lineage for d3ju6d1 (3ju6 D:2-93)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332344Fold a.83: Guanido kinase N-terminal domain [48033] (1 superfamily)
    irregular array of 6 short helices
  4. 2332345Superfamily a.83.1: Guanido kinase N-terminal domain [48034] (2 families) (S)
    automatically mapped to Pfam PF02807
  5. 2332346Family a.83.1.1: Guanido kinase N-terminal domain [48035] (2 proteins)
  6. 2332347Protein Arginine kinase, N-domain [48042] (2 species)
  7. 2332348Species Apostichopus japonicus [TaxId:307972] [226828] (2 PDB entries)
  8. 2332356Domain d3ju6d1: 3ju6 D:2-93 [212099]
    Other proteins in same PDB: d3ju6a2, d3ju6b2, d3ju6c2, d3ju6d2
    automated match to d1g0wa1
    complexed with anp, arg

Details for d3ju6d1

PDB Entry: 3ju6 (more details), 2.45 Å

PDB Description: Crystal Structure of Dimeric Arginine Kinase in Complex with AMPPNP and Arginine
PDB Compounds: (D:) arginine kinase

SCOPe Domain Sequences for d3ju6d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ju6d1 a.83.1.1 (D:2-93) Arginine kinase, N-domain {Apostichopus japonicus [TaxId: 307972]}
anlnqkkypakddfpnfeghksllskyltadmyaklrdvatpsgytldraiqngvdnpdf
hlgllagdeetytvfadlfdpvieeyhngfkk

SCOPe Domain Coordinates for d3ju6d1:

Click to download the PDB-style file with coordinates for d3ju6d1.
(The format of our PDB-style files is described here.)

Timeline for d3ju6d1: