Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest |
Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) |
Family c.71.1.0: automated matches [191485] (1 protein) not a true family |
Protein automated matches [190777] (19 species) not a true protein |
Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [225827] (1 PDB entry) |
Domain d3ix9b_: 3ix9 B: [211998] automated match to d3tq8a_ complexed with mtx, ndp; mutant |
PDB Entry: 3ix9 (more details), 1.95 Å
SCOPe Domain Sequences for d3ix9b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ix9b_ c.71.1.0 (B:) automated matches {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]} tkkivaiwaqdeegvigkdnrlpwylpaelqhfkettlnhailmgrvtfdgmgrrllpkr etliltrnpeekidgvatfhdvqsvldwysaqeknlyivggkqifqafepyldevivthi harvegdtyfpaefdlslfetvsskfytkdeknpydftiqyrkrke
Timeline for d3ix9b_: