SCOPe 2.05: Domain d3ix9b_: 3ix9 B:

Lineage for d3ix9b_ (3ix9 B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.0: automated matches [191485] (1 protein)
   not a true family

6. Protein automated matches [190777] (19 species)
   not a true protein

7. Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [225827] (1 PDB entry)

8. Domain d3ix9b_: 3ix9 B: [211998]
   automated match to d3tq8a_
   complexed with mtx, ndp; mutant

Details for d3ix9b_

PDB Entry: 3ix9, 1.95 Å

PDB Description: crystal structure of streptococcus pneumoniae dihydrofolate reductase - sp9 mutant

PDB Compounds: (B:) dihydrofolate reductase

SCOPe Domain Sequences for d3ix9b_:

Sequence; same for both SEQRES and ATOM records:

>d3ix9b_ c.71.1.0 (B:) automated matches {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
tkkivaiwaqdeegvigkdnrlpwylpaelqhfkettlnhailmgrvtfdgmgrrllpkr
etliltrnpeekidgvatfhdvqsvldwysaqeknlyivggkqifqafepyldevivthi
harvegdtyfpaefdlslfetvsskfytkdeknpydftiqyrkrke

Timeline for d3ix9b_:

• d3ix9b_ first appeared in SCOPe 2.03
  
• d3ix9b_ appears in SCOPe 2.04
  
• d3ix9b_ appears in SCOPe 2.06
  
• d3ix9b_ appears in the current release, SCOPe 2.08