SCOPe 2.04: Domain d3iwea2: 3iwe A:296-496

Lineage for d3iwea2 (3iwe A:296-496)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families)

5. Family d.108.1.0: automated matches [191308] (1 protein)
   not a true family

6. Protein automated matches [190038] (28 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225745] (14 PDB entries)

8. Domain d3iwea2: 3iwe A:296-496 [211974]
   automated match to d1iyka2
   complexed with 646, mya

Details for d3iwea2

PDB Entry: 3iwe, 1.79 Å

PDB Description: Crystal Structure of human type-I N-myristoyltransferase with bound myristoyl-CoA and inhibitor DDD85646

PDB Compounds: (A:) Glycylpeptide N-tetradecanoyltransferase 1

SCOPe Domain Sequences for d3iwea2:

Sequence; same for both SEQRES and ATOM records:

>d3iwea2 d.108.1.0 (A:296-496) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ywhrslnprklievkfshlsrnmtmqrtmklyrlpetpktaglrpmetkdipvvhqlltr
ylkqfhltpvmsqeevehwfypqeniidtfvvenangevtdflsfytlpstimnhpthks
lkaaysfynvhtqtplldlmsdalvlakmkgfdvfnaldlmenktfleklkfgigdgnlq
yylynwkcpsmgaekvglvlq

Timeline for d3iwea2:

• d3iwea2 first appeared in SCOPe 2.03
  
• d3iwea2 appears in SCOPe 2.05
  
• d3iwea2 appears in the current release, SCOPe 2.08