Lineage for d3itha2 (3ith A:430-556)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1605035Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1606596Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 1606597Family c.55.3.1: Ribonuclease H [53099] (5 proteins)
  6. 1606644Protein HIV RNase H (Domain of reverse transcriptase) [53105] (3 species)
  7. 1606654Species Human immunodeficiency virus type 1 [TaxId:11676] [53106] (102 PDB entries)
    Uniprot P04585 159-692 # chain A coverage; chain B is shorter: 162-582 ! Uniprot P03366 186-725 # chain A coverage; chain B coverage: 156-584 ! Uniprot P04585 158-698 # chain A coverage; chain B is shorter: 159-595
  8. 1606699Domain d3itha2: 3ith A:430-556 [211947]
    Other proteins in same PDB: d3itha1, d3ithb_, d3ithc1, d3ithd_
    automated match to d1ikwa1
    complexed with edm

Details for d3itha2

PDB Entry: 3ith (more details), 2.8 Å

PDB Description: Crystal structure of the HIV-1 reverse transcriptase bound to a 6-vinylpyrimidine inhibitor
PDB Compounds: (A:) Reverse transcriptase/ribonuclease H

SCOPe Domain Sequences for d3itha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3itha2 c.55.3.1 (A:430-556) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1 [TaxId: 11676]}
ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktqlqaiylalqds
glevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggneqvd
klvsagi

SCOPe Domain Coordinates for d3itha2:

Click to download the PDB-style file with coordinates for d3itha2.
(The format of our PDB-style files is described here.)

Timeline for d3itha2: