SCOPe 2.06: Domain d3inul2: 3inu L:108-211

Lineage for d3inul2 (3inu L:108-211)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (16 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (698 PDB entries)

8. Domain d3inul2: 3inu L:108-211 [211828]
   Other proteins in same PDB: d3inul1, d3inun1
   automated match to d3fcta2
   complexed with gol, so4

Details for d3inul2

PDB Entry: 3inu, 2.5 Å

PDB Description: crystal structure of an unbound kz52 neutralizing anti-ebolavirus antibody.

PDB Compounds: (L:) KZ52 antibody fragment light chain

SCOPe Domain Sequences for d3inul2:

Sequence; same for both SEQRES and ATOM records:

>d3inul2 b.1.1.2 (L:108-211) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglrspvtksfnr

Timeline for d3inul2:

• d3inul2 first appeared in SCOPe 2.03
  
• d3inul2 appears in SCOPe 2.05
  
• d3inul2 appears in SCOPe 2.07
  
• d3inul2 appears in the current release, SCOPe 2.08