Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) |
Family d.169.1.1: C-type lectin domain [56437] (29 proteins) Pfam PF00059 |
Protein Surfactant protein, lectin domain [56461] (3 species) |
Species Human (Homo sapiens), SP-D [TaxId:9606] [56462] (11 PDB entries) |
Domain d3ikra2: 3ikr A:235-355 [211804] Other proteins in same PDB: d3ikra1, d3ikrb1, d3ikrc1 automated match to d1pwba1 complexed with ca, man |
PDB Entry: 3ikr (more details), 1.65 Å
SCOPe Domain Sequences for d3ikra2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ikra2 d.169.1.1 (A:235-355) Surfactant protein, lectin domain {Human (Homo sapiens), SP-D [TaxId: 9606]} pngqsvgekifktagfvkpfteaqllctqaggqlasprsaaenaalqqlvvakneaafls mtdsktegkftyptgeslvysnwapgepnddggsedcveiftngkwndracgekrlvvce f
Timeline for d3ikra2:
View in 3D Domains from other chains: (mouse over for more information) d3ikrb1, d3ikrb2, d3ikrc1, d3ikrc2 |