Lineage for d3ikra2 (3ikr A:235-355)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1442549Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 1442550Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 1442551Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 1442937Protein Surfactant protein, lectin domain [56461] (3 species)
  7. 1442938Species Human (Homo sapiens), SP-D [TaxId:9606] [56462] (9 PDB entries)
  8. 1442945Domain d3ikra2: 3ikr A:235-355 [211804]
    Other proteins in same PDB: d3ikra1, d3ikrb1, d3ikrc1
    automated match to d1pwba1
    complexed with ca, man

Details for d3ikra2

PDB Entry: 3ikr (more details), 1.65 Å

PDB Description: crystal structure of alpha 1-4 mannobiose bound trimeric human lung surfactant protein d
PDB Compounds: (A:) Pulmonary surfactant-associated protein D

SCOPe Domain Sequences for d3ikra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ikra2 d.169.1.1 (A:235-355) Surfactant protein, lectin domain {Human (Homo sapiens), SP-D [TaxId: 9606]}
pngqsvgekifktagfvkpfteaqllctqaggqlasprsaaenaalqqlvvakneaafls
mtdsktegkftyptgeslvysnwapgepnddggsedcveiftngkwndracgekrlvvce
f

SCOPe Domain Coordinates for d3ikra2:

Click to download the PDB-style file with coordinates for d3ikra2.
(The format of our PDB-style files is described here.)

Timeline for d3ikra2: