Lineage for d3ikqa2 (3ikq A:235-355)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2607278Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2607279Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2607280Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 2607677Protein Surfactant protein, lectin domain [56461] (3 species)
  7. 2607678Species Human (Homo sapiens), SP-D [TaxId:9606] [56462] (11 PDB entries)
  8. 2607709Domain d3ikqa2: 3ikq A:235-355 [211798]
    Other proteins in same PDB: d3ikqa1, d3ikqb1, d3ikqc1
    automated match to d1pwba1
    complexed with ca, man

Details for d3ikqa2

PDB Entry: 3ikq (more details), 2.25 Å

PDB Description: crystal structure of alpha 1-2 mannobiose bound trimeric human lung surfactant protein d
PDB Compounds: (A:) Pulmonary surfactant-associated protein D

SCOPe Domain Sequences for d3ikqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ikqa2 d.169.1.1 (A:235-355) Surfactant protein, lectin domain {Human (Homo sapiens), SP-D [TaxId: 9606]}
pngqsvgekifktagfvkpfteaqllctqaggqlasprsaaenaalqqlvvakneaafls
mtdsktegkftyptgeslvysnwapgepnddggsedcveiftngkwndracgekrlvvce
f

SCOPe Domain Coordinates for d3ikqa2:

Click to download the PDB-style file with coordinates for d3ikqa2.
(The format of our PDB-style files is described here.)

Timeline for d3ikqa2: