Lineage for d3ikpa1 (3ikp A:205-234)

  1. Root: SCOPe 2.04
  2. 1708126Class h: Coiled coil proteins [57942] (7 folds)
  3. 1708127Fold h.1: Parallel coiled-coil [57943] (34 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 1708128Superfamily h.1.1: Triple coiled coil domain of C-type lectins [57944] (1 family) (S)
  5. 1708129Family h.1.1.1: Triple coiled coil domain of C-type lectins [57945] (3 proteins)
  6. 1708201Protein Surfactant protein [57949] (2 species)
  7. 1708202Species Human (Homo sapiens), SP-D [TaxId:9606] [57950] (24 PDB entries)
  8. 1708257Domain d3ikpa1: 3ikp A:205-234 [211791]
    Other proteins in same PDB: d3ikpa2, d3ikpb2, d3ikpc2
    automated match to d1pwba2
    complexed with ca, ipd

Details for d3ikpa1

PDB Entry: 3ikp (more details), 1.75 Å

PDB Description: crystal structure of inositol phosphate bound trimeric human lung surfactant protein d
PDB Compounds: (A:) Pulmonary surfactant-associated protein D

SCOPe Domain Sequences for d3ikpa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ikpa1 h.1.1.1 (A:205-234) Surfactant protein {Human (Homo sapiens), SP-D [TaxId: 9606]}
aslrqqvealqgqvqhlqaafsqykkvelf

SCOPe Domain Coordinates for d3ikpa1:

Click to download the PDB-style file with coordinates for d3ikpa1.
(The format of our PDB-style files is described here.)

Timeline for d3ikpa1: