![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
![]() | Superfamily d.169.1: C-type lectin-like [56436] (9 families) ![]() |
![]() | Family d.169.1.1: C-type lectin domain [56437] (29 proteins) Pfam PF00059 |
![]() | Protein Surfactant protein, lectin domain [56461] (3 species) |
![]() | Species Human (Homo sapiens), SP-D [TaxId:9606] [56462] (9 PDB entries) |
![]() | Domain d3iknc2: 3ikn C:235-355 [211790] Other proteins in same PDB: d3ikna1, d3iknb1, d3iknc1 automated match to d1pwba1 complexed with ca, gal |
PDB Entry: 3ikn (more details), 1.6 Å
SCOPe Domain Sequences for d3iknc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3iknc2 d.169.1.1 (C:235-355) Surfactant protein, lectin domain {Human (Homo sapiens), SP-D [TaxId: 9606]} pngqsvgekifktagfvkpfteaqllctqaggqlasprsaaenaalqqlvvakneaafls mtdsktegkftyptgeslvysnwapgepnddggsedcveiftngkwndracgekrlvvce f
Timeline for d3iknc2:
![]() Domains from other chains: (mouse over for more information) d3ikna1, d3ikna2, d3iknb1, d3iknb2 |