Lineage for d3ikhd_ (3ikh D:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1618889Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 1618890Superfamily c.72.1: Ribokinase-like [53613] (6 families) (S)
    has extra strand located between strands 2 and 3
  5. 1619116Family c.72.1.0: automated matches [191321] (1 protein)
    not a true family
  6. 1619117Protein automated matches [190117] (35 species)
    not a true protein
  7. 1619205Species Klebsiella pneumoniae [TaxId:272620] [225726] (2 PDB entries)
  8. 1619209Domain d3ikhd_: 3ikh D: [211784]
    automated match to d2fv7a1
    complexed with atp, gol

Details for d3ikhd_

PDB Entry: 3ikh (more details), 1.88 Å

PDB Description: crystal structure of ribokinase in complex with atp and glycerol in the active site from klebsiella pneumoniae
PDB Compounds: (D:) carbohydrate kinase

SCOPe Domain Sequences for d3ikhd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ikhd_ c.72.1.0 (D:) automated matches {Klebsiella pneumoniae [TaxId: 272620]}
slrvyvtgnitvdetwsipdipkkgasihgvkvsqdiggkganqaiilsrcgietrliaa
tgndsngawirqqikneplmllpdghfnqhsdtsiilnsadgdnaiitttaaadtfslde
miphmadavagdillqqgnfsldktralfqyarsrgmttvfnpspvnpdfchlwplidia
vvneseaellqpygvktlvitqgaagawlvqegqrqfcpavpaealdttgagdtflavml
asallrgvapdalalahasraaaitvsrrgtlsafpgsrelaallt

SCOPe Domain Coordinates for d3ikhd_:

Click to download the PDB-style file with coordinates for d3ikhd_.
(The format of our PDB-style files is described here.)

Timeline for d3ikhd_: