Lineage for d3ieza_ (3iez A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2242910Fold d.332: RGC domain-like [143884] (1 superfamily)
    consists of two beta-sheets and four helices eclosing a cental cavity
  4. 2242911Superfamily d.332.1: RGC domain-like [143885] (1 family) (S)
  5. 2242912Family d.332.1.1: RGC domain [143886] (2 proteins)
    Pfam PF03836; RasGAP C-terminus
  6. 2242916Protein automated matches [227022] (1 species)
    not a true protein
  7. 2242917Species Human (Homo sapiens) [TaxId:9606] [225779] (2 PDB entries)
  8. 2242920Domain d3ieza_: 3iez A: [211621]
    automated match to d1x0ha1
    complexed with unx

Details for d3ieza_

PDB Entry: 3iez (more details), 1.5 Å

PDB Description: crystal structure of the rasgap c-terminal (rgc) domain of iqgap2
PDB Compounds: (A:) Ras GTPase-activating-like protein IQGAP2

SCOPe Domain Sequences for d3ieza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ieza_ d.332.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kpvkytaaklhekgvlldiddlqtnqfknvtfdiiatedvgifdvrskflgvemekvqln
iqdllqmqyegvavmkmfdkvkvnvnlliyllnk

SCOPe Domain Coordinates for d3ieza_:

Click to download the PDB-style file with coordinates for d3ieza_.
(The format of our PDB-style files is described here.)

Timeline for d3ieza_: