Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (9 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [224855] (343 PDB entries) |
Domain d3ietc2: 3iet C:108-213 [211616] Other proteins in same PDB: d3ieta1, d3ietc1 automated match to d1t66c2 complexed with a2g, zn |
PDB Entry: 3iet (more details), 2.2 Å
SCOPe Domain Sequences for d3ietc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ietc2 b.1.1.2 (C:108-213) automated matches {Mouse (Mus musculus) [TaxId: 10090]} radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd skdstysmsstltltkdeyerhnsytceathktstspivksfnrec
Timeline for d3ietc2: