SCOPe 2.07: Domain d3ieta1: 3iet A:2-107

Lineage for d3ieta1 (3iet A:2-107)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (22 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [186842] (212 PDB entries)

8. Domain d3ieta1: 3iet A:2-107 [211613]
   Other proteins in same PDB: d3ieta2, d3ietc2
   automated match to d1t66c1
   complexed with a2g, zn

Details for d3ieta1

PDB Entry: 3iet, 2.2 Å

PDB Description: crystal structure of 237mab with antigen

PDB Compounds: (A:) Immunoglobulin light chain (IgG2a)

SCOPe Domain Sequences for d3ieta1:

Sequence; same for both SEQRES and ATOM records:

>d3ieta1 b.1.1.1 (A:2-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iqltqtplslpvslgdqasiscrssqslvhsngntylhwylqkpgqspklliykvsnrfs
gvpdrfsgsgsgtdftlkissveaedlgvyfcsqsthvptfgggtkleik

Timeline for d3ieta1:

• d3ieta1 first appeared in SCOPe 2.03
  
• d3ieta1 appears in SCOPe 2.06
  
• d3ieta1 appears in the current release, SCOPe 2.08