Lineage for d3ie3a1 (3ie3 A:1-78)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1368269Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1368270Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1368661Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)
  6. 1368986Protein Class pi GST [81358] (4 species)
  7. 1368987Species Human (Homo sapiens) [TaxId:9606] [52864] (49 PDB entries)
  8. 1369056Domain d3ie3a1: 3ie3 A:1-78 [211598]
    Other proteins in same PDB: d3ie3a2, d3ie3b2
    automated match to d1gssa2
    complexed with gsh, mes, n11

Details for d3ie3a1

PDB Entry: 3ie3 (more details), 1.8 Å

PDB Description: structural basis for the binding of the anti-cancer compound 6-(7- nitro-2,1,3-benzoxadiazol-4-ylthio)hexanol (nbdhex) to human glutathione s-transferases
PDB Compounds: (A:) Glutathione S-transferase P

SCOPe Domain Sequences for d3ie3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ie3a1 c.47.1.5 (A:1-78) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}
ppytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdl
tlyqsntilrhlgrtlgl

SCOPe Domain Coordinates for d3ie3a1:

Click to download the PDB-style file with coordinates for d3ie3a1.
(The format of our PDB-style files is described here.)

Timeline for d3ie3a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ie3a2