SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3ie3a1 (3ie3 A:1-78)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2116932Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2116933Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2117361Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 protein domains)
  6. 2117676Protein Class pi GST [81358] (4 species)
  7. 2117677Species Human (Homo sapiens) [TaxId:9606] [52864] (55 PDB entries)
  8. 2117719Domain d3ie3a1: 3ie3 A:1-78 [211598]
    Other proteins in same PDB: d3ie3a2, d3ie3b2
    automated match to d1gssa2
    complexed with gsh, mes, n11

Details for d3ie3a1

PDB Entry: 3ie3 (more details), 1.8 Å

PDB Description: Structural basis for the binding of the anti-cancer compound 6-(7-Nitro-2,1,3-benzoxadiazol-4-ylthio)hexanol (NBDHEX) to human glutathione S-transferases
PDB Compounds: (A:) Glutathione S-transferase P

SCOPe Domain Sequences for d3ie3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ie3a1 c.47.1.5 (A:1-78) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}
ppytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdl
tlyqsntilrhlgrtlgl

SCOPe Domain Coordinates for d3ie3a1:

Click to download the PDB-style file with coordinates for d3ie3a1.
(The format of our PDB-style files is described here.)

Timeline for d3ie3a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ie3a2