![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
![]() | Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
![]() | Protein automated matches [226839] (63 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [224896] (68 PDB entries) |
![]() | Domain d3id8a2: 3id8 A:219-457 [211575] Other proteins in same PDB: d3id8a3 automated match to d1bdga2 complexed with anp, glc, k, mg, mrk |
PDB Entry: 3id8 (more details), 2.4 Å
SCOPe Domain Sequences for d3id8a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3id8a2 c.55.1.0 (A:219-457) automated matches {Human (Homo sapiens) [TaxId: 9606]} qcevgmivgtgcnacymeemqnvelvegdegrmcvntewgafgdsgeldeflleydrlvd essanpgqqlyekliggkymgelvrlvllrlvdenllfhgeaseqlrtrgafetrfvsqv esdtgdrkqiynilstlglrpsttdcdivrracesvstraahmcsaglagvinrmresrs edvmritvgvdgsvyklhpsfkerfhasvrrltpsceitfieseegsgrgaalvsavac
Timeline for d3id8a2: