SCOPe 2.08: Domain d3icna_: 3icn A:

Lineage for d3icna_ (3icn A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.128: Terpenoid synthases [48575] (1 superfamily)
   multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers

4. Superfamily a.128.1: Terpenoid synthases [48576] (6 families)
   duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J

5. Family a.128.1.0: automated matches [196408] (1 protein)
   not a true family

6. Protein automated matches [196409] (46 species)
   not a true protein

7. Species Trypanosoma cruzi [TaxId:5693] [196823] (68 PDB entries)

8. Domain d3icna_: 3icn A: [211571]
   automated match to d4dwba_
   complexed with ipe, mg, ni9, so4

Details for d3icna_

PDB Entry: 3icn, 2.4 Å

PDB Description: trypanosoma cruzi farnesyl diphosphate synthase homodimer in complex with isopentenyl pyrophosphate and 3-fluoro-1-(2-hydroxy-2,2-bis- phosphono-ethyl)-pyridinium

PDB Compounds: (A:) farnesyl pyrophosphate synthase

SCOPe Domain Sequences for d3icna_:

Sequence; same for both SEQRES and ATOM records:

>d3icna_ a.128.1.0 (A:) automated matches {Trypanosoma cruzi [TaxId: 5693]}
masmerflsvydevqaflldqlqskyeidpnrarylrimmdttclggkyfrgmtvvnvae
gflavtqhdeatkerilhdacvggwmieflqahylveddimdgsvmrrgkpcwyrfpgvt
tqcaindgiilkswtqimawhyfadrpflkdllclfqkvdyatavgqmydvtsmcdsnkl
dpevaqpmttdfaeftpaiykrivkykttfytyllplvmglfvseaaasvemnlvervah
ligeyfqvqddvmdcftppeqlgkvgtdiedakcswlavtflgkanaaqvaefkanygdk
dpakvavvkrlyseanlqadfaayeaevvreveslieqlkvksptfaesvavvwekthkr
kk

Timeline for d3icna_:

• d3icna_ first appeared in SCOPe 2.03
  
• d3icna_ appears in SCOPe 2.07