SCOPe 2.04: Domain d3i69c2: 3i69 C:81-220

Lineage for d3i69c2 (3i69 C:81-220)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein Class alpha GST [81349] (8 species)

7. Species Human (Homo sapiens), (a1-1) [TaxId:9606] [47625] (27 PDB entries)
   Uniprot P08263

8. Domain d3i69c2: 3i69 C:81-220 [211507]
   Other proteins in same PDB: d3i69a1, d3i69b1, d3i69c1, d3i69d1, d3i69e1, d3i69f1, d3i69g1, d3i69h1
   automated match to d1agsa1
   complexed with gsh; mutant

Details for d3i69c2

PDB Entry: 3i69, 2.38 Å

PDB Description: apo glutathione transferase a1-1 gimf-helix mutant

PDB Compounds: (C:) glutathione s-transferase a1

SCOPe Domain Sequences for d3i69c2:

Sequence; same for both SEQRES and ATOM records:

>d3i69c2 a.45.1.1 (C:81-220) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]}
lygkdikeralidmyiegiadlgemiimlpfcppeekdaklalikekiknryfpafekvl
kshgqdylvgnklsradihlvellyyveeldsslissfpllkalktrisnlptvkkflqp
gsprkpppdeiyvrtvynif

Timeline for d3i69c2:

• d3i69c2 first appeared in SCOPe 2.03
  
• d3i69c2 appears in SCOPe 2.05
  
• d3i69c2 appears in the current release, SCOPe 2.08